|
|
|
|
|
|
|
| Information on 1l1d_A_392 |
|
Loop code: 1l1d_A_392 PDB: 1l1d Chain: A Type: HE alpha-beta |
Loop Start: 392 Loop Length: 17 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | EEQYQVTQNSATEYAFSHEYDHLFKPGIYVD |
| Sec Struct: | HHHHHHHHH-----TT-SGGGG---SEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACCACODYLATE ION | T - 403 | 0 | 1 |
| CACCACODYLATE ION | E - 404 | 0 | 1 |
| MSESELENOMETHIONINE | P - 417 | 0 | 1 |
| MSESELENOMETHIONINE | G - 418 | 0 | 1 |
| MSESELENOMETHIONINE | I - 419 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|