|
|
|
|
|
|
|
| Information on 1fr2_B_73 |
|
Loop code: 1fr2_B_73 PDB: 1fr2 Chain: B Type: HE alpha-beta |
Loop Start: 73 Loop Length: 19 Sec Struct Nt length: 8 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | PSNKSSVSKGYSPFTPKNQQVGGRKVYELHH |
| Sec Struct: | HHHHHHHHTT---B--GGG-BTTB-B-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | L - 101 | 1 | 0 |
| ZNZINC ION | L - 101 | 1 | 0 |
| PO4PHOSPHATE ION | H - 102 | 1 | 0 |
| ZNZINC ION | H - 102 | 1 | 0 |
| PO4PHOSPHATE ION | H - 103 | 1 | 0 |
| ZNZINC ION | H - 103 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|