|
|
|
|
|
|
|
| Information on 1m0d_A_18 |
|
Loop code: 1m0d_A_18 PDB: 1m0d Chain: A Type: HE alpha-beta |
Loop Start: 18 Loop Length: 26 Sec Struct Nt length: 12 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | GLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFL |
| Sec Struct: | HHHHHHHHHHHHTT----SS-----------------SEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MNMANGANESE (II) ION | E - 20 | 1 | 0 |
| MNMANGANESE (II) ION | Y - 36 | 0 | 1 |
| MNMANGANESE (II) ION | E - 37 | 0 | 1 |
| MNMANGANESE (II) ION | T - 53 | 0 | 1 |
| MNMANGANESE (II) ION | P - 54 | 0 | 1 |
| MNMANGANESE (II) ION | D - 55 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|