|
|
|
|
|
|
|
| Information on 1i0v_A_13 |
|
Loop code: 1i0v_A_13 PDB: 1i0v Chain: A Type: HE alpha-beta |
Loop Start: 13 Loop Length: 10 Sec Struct Nt length: 17 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | SSDVSTAQAAGYKLHEDGETVGSNSYPHKY |
| Sec Struct: | HHHHHHHHHHHHHHHHHT--BTTTTBSEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | S - 14 | 1 | 0 |
| CACALCIUM ION | D - 15 | 1 | 0 |
| 2GPGUANOSINE-2'-MONOPHOSPHATE | N - 36 | 0 | 1 |
| 2GPGUANOSINE-2'-MONOPHOSPHATE | Y - 38 | 0 | 1 |
| 2GPGUANOSINE-2'-MONOPHOSPHATE | H - 40 | 0 | 1 |
| 2GPGUANOSINE-2'-MONOPHOSPHATE | K - 41 | 1 | 0 |
| 2GPGUANOSINE-2'-MONOPHOSPHATE | Y - 42 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|