|
|
|
|
|
|
|
| Information on 1iw7_C_1060 |
|
Loop code: 1iw7_C_1060 PDB: 1iw7 Chain: C Type: HH alpha-alpha |
Loop Start: 1060 Loop Length: 10 Sec Struct Nt length: 13 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | IEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQA |
| Sec Struct: | HHHHHHHHHHHHHTS--------HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | V - 1076 | 0 | 1 |
| MGMAGNESIUM ION | P - 1077 | 0 | 1 |
| MGMAGNESIUM ION | E - 1078 | 0 | 1 |
| MGMAGNESIUM ION | P - 1079 | 0 | 1 |
| MGMAGNESIUM ION | S - 1080 | 0 | 1 |
| MGMAGNESIUM ION | V - 1081 | 0 | 1 |
| MGMAGNESIUM ION | S - 1084 | 1 | 0 |
| MGMAGNESIUM ION | L - 1088 | 1 | 0 |
| MGMAGNESIUM ION | E - 1091 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|