|
|
|
|
|
|
|
| Information on 1jqn_A_792 |
|
Loop code: 1jqn_A_792 PDB: 1jqn Chain: A Type: HH alpha-alpha |
Loop Start: 792 Loop Length: 10 Sec Struct Nt length: 21 Sec Struct Ct length: 34 Structure geometry
|
| Sequence: | WPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLNVLQAELLHRSRQAEKE |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHTT-SSTTTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ASPASPARTIC ACID | M - 819 | 0 | 1 |
| ASPASPARTIC ACID | L - 822 | 0 | 1 |
| ASPASPARTIC ACID | I - 825 | 1 | 0 |
| ASPASPARTIC ACID | S - 828 | 1 | 0 |
| ASPASPARTIC ACID | I - 829 | 1 | 0 |
| ASPASPARTIC ACID | R - 832 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|