|
|
|
|
|
|
|
| Information on 1h16_A_251 |
|
Loop code: 1h16_A_251 PDB: 1h16 Chain: A Type: HH alpha-alpha |
Loop Start: 251 Loop Length: 11 Sec Struct Nt length: 18 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | AQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLK |
| Sec Struct: | HHHHHHHHHHHHHHHHHH--BS----BS-HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PYRPYRUVIC ACID | A - 272 | 0 | 1 |
| PYRPYRUVIC ACID | A - 273 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| NA3 - NA BINDING SITE FOR CHAIN A | S - 268 | 0 | 1 |
| PYR - PYR BINDING SITE FOR CHAIN A | A - 273 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|