|
|
|
|
|
|
|
| Information on 1oao_C_216 |
|
Loop code: 1oao_C_216 PDB: 1oao Chain: C Type: HH alpha-alpha |
Loop Start: 216 Loop Length: 9 Sec Struct Nt length: 12 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | VHAANYALRAGMMFGGVTPGAREEQRDYQRRR |
| Sec Struct: | HHHHHHHHHHHHTTT---TT-HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | M - 227 | 0 | 1 |
| NINICKEL (II) ION | F - 229 | 0 | 1 |
| SXSULFUR OXIDE | F - 229 | 0 | 1 |
| ZNZINC ION | F - 229 | 0 | 1 |
| GOLGLYCEROL | P - 234 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| FC2 - SX BINDING SITE FOR CHAIN C | F - 229 | 0 | 1 |
| FC7 - SO4 BINDING SITE FOR CHAIN C | R - 237 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|