|
|
|
|
|
|
|
| Information on 1n8i_A_460 |
|
Loop code: 1n8i_A_460 PDB: 1n8i Chain: A Type: HH alpha-alpha |
Loop Start: 460 Loop Length: 16 Sec Struct Nt length: 11 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | FLDRTGDEIHTSMEAGPMVRKGTMKSQPWILAYEDHNVDAGLA |
| Sec Struct: | HHHHHHHHHHHTGGG--B--GGGGGGSHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GLVGLYOXYLIC ACID | F - 460 | 1 | 0 |
| GLVGLYOXYLIC ACID | L - 461 | 1 | 0 |
| MGMAGNESIUM ION | L - 461 | 1 | 0 |
| GLVGLYOXYLIC ACID | D - 462 | 1 | 0 |
| MGMAGNESIUM ION | D - 462 | 1 | 0 |
| GLVGLYOXYLIC ACID | R - 463 | 1 | 0 |
| MGMAGNESIUM ION | R - 463 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|