|
|
|
|
|
|
|
| Information on 1p7t_A_453 |
|
Loop code: 1p7t_A_453 PDB: 1p7t Chain: A Type: HH alpha-alpha |
Loop Start: 453 Loop Length: 16 Sec Struct Nt length: 11 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | FLDRTGDEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLF |
| Sec Struct: | HHHHHHHHHHHTGGGS-B--GGGSTT-HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PYRPYRUVIC ACID | F - 453 | 1 | 0 |
| ACOACETYL COENZYME *A | L - 454 | 1 | 0 |
| MGMAGNESIUM ION | L - 454 | 1 | 0 |
| PYRPYRUVIC ACID | L - 454 | 1 | 0 |
| ACOACETYL COENZYME *A | D - 455 | 1 | 0 |
| MGMAGNESIUM ION | D - 455 | 1 | 0 |
| PYRPYRUVIC ACID | D - 455 | 1 | 0 |
| PYRPYRUVIC ACID | R - 456 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|