|
|
|
|
|
|
|
| Information on 1jqk_A_76 |
|
Loop code: 1jqk_A_76 PDB: 1jqk Chain: A Type: HH alpha-alpha |
Loop Start: 76 Loop Length: 12 Sec Struct Nt length: 34 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | RDTIVARHLVRMIAAGTAAHSEHGRHIALAMQHISQGELHDYSIRDEAKLYAIAKT |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT--TT---TTHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FE2FE (II) ION | I - 79 | 1 | 0 |
| SF4IRON/SULFUR CLUSTER | I - 79 | 1 | 0 |
| FE2FE (II) ION | R - 82 | 1 | 0 |
| SF4IRON/SULFUR CLUSTER | R - 82 | 1 | 0 |
| FE2FE (II) ION | H - 95 | 1 | 0 |
| UNXUNKNOWN ATOM OR ION | H - 95 | 1 | 0 |
| WCCFE(3)-NI(1)-S(4) CLUSTER | H - 95 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|