|
|
|
|
|
|
|
| Information on 2kfn_A_491 |
|
Loop code: 2kfn_A_491 PDB: 2kfn Chain: A Type: HH alpha-alpha |
Loop Start: 491 Loop Length: 4 Sec Struct Nt length: 25 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | LEEAGRYAAEDADVTLQLHLKMWPDLQKHKGPLNVFEN |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHTTS-HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SSULFUR ATOM | Y - 497 | 1 | 0 |
| ZNZINC ION | Y - 497 | 1 | 0 |
| ZNZINC ION | A - 498 | 1 | 0 |
| MNMANGANESE (II) ION | D - 501 | 1 | 0 |
| SSULFUR ATOM | D - 501 | 1 | 0 |
| ZNZINC ION | D - 501 | 1 | 0 |
| ZNZINC ION | A - 502 | 1 | 0 |
| Associated ArchDB-EC Subclass to 2kfn_A_491 |
| For any comment or web-related incidence, send an email to the webmaster. |
|