|
|
|
|
|
|
|
| Information on 1msk_*_1082 |
|
Loop code: 1msk_*_1082 PDB: 1msk Chain: * Type: HH alpha-alpha |
Loop Start: 1082 Loop Length: 12 Sec Struct Nt length: 28 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | DYNKIMVKALADRLAEAFAEYLHERVRKVYWGYAPNENLSNEELI |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-S-TT----HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SAMS-ADENOSYLMETHIONINE | R - 1094 | 1 | 0 |
| SAMS-ADENOSYLMETHIONINE | E - 1097 | 1 | 0 |
| SAMS-ADENOSYLMETHIONINE | A - 1098 | 1 | 0 |
| SAMS-ADENOSYLMETHIONINE | E - 1101 | 1 | 0 |
| ACTACETATE ION | Y - 1102 | 1 | 0 |
| ACTACETATE ION | L - 1103 | 1 | 0 |
| ACTACETATE ION | R - 1106 | 1 | 0 |
| ACTACETATE ION | Y - 1111 | 0 | 1 |
| SAMS-ADENOSYLMETHIONINE | I - 1126 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|