|
|
|
|
|
|
|
| Information on 1cvu_A_348 |
|
Loop code: 1cvu_A_348 PDB: 1cvu Chain: A Type: HH alpha-alpha |
Loop Start: 348 Loop Length: 25 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | YVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTL |
| Sec Struct: | HHHHHHT-SS-----GGGGTTS---S----BHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACDARACHIDONIC ACID | Y - 348 | 1 | 0 |
| ACDARACHIDONIC ACID | V - 349 | 1 | 0 |
| ACDARACHIDONIC ACID | L - 352 | 0 | 1 |
| ACDARACHIDONIC ACID | S - 353 | 0 | 1 |
| ACDARACHIDONIC ACID | Y - 355 | 0 | 1 |
| ACDARACHIDONIC ACID | L - 359 | 0 | 1 |
| ACDARACHIDONIC ACID | K - 360 | 0 | 1 |
| ACDARACHIDONIC ACID | F - 381 | 1 | 0 |
| BOGB-OCTYLGLUCOSIDE | N - 382 | 1 | 0 |
| ACDARACHIDONIC ACID | L - 384 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|