|
|
|
|
|
|
|
| Information on 1hbn_A_7 |
|
Loop code: 1hbn_A_7 PDB: 1hbn Chain: A Type: HH alpha-alpha |
Loop Start: 7 Loop Length: 21 Sec Struct Nt length: 7 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | INALKKKFEESPEEKKTTFYTLGGWKQSERKTEFVNAGKEVAAKR |
| Sec Struct: | HHHHHHH-SS-TT------S-S-GGGG-HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 15 | 0 | 1 |
| MGMAGNESIUM ION | E - 16 | 0 | 1 |
| MGMAGNESIUM ION | S - 17 | 0 | 1 |
| MGMAGNESIUM ION | E - 20 | 0 | 1 |
| MGMAGNESIUM ION | K - 22 | 0 | 1 |
| MGMAGNESIUM ION | T - 23 | 0 | 1 |
| MGMAGNESIUM ION | T - 24 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|