|
|
|
|
|
|
|
| Information on 1hbn_A_342 |
|
Loop code: 1hbn_A_342 PDB: 1hbn Chain: A Type: HH alpha-alpha |
Loop Start: 342 Loop Length: 9 Sec Struct Nt length: 16 Sec Struct Ct length: 21 Structure geometry
|
| Sequence: | ILDDFTYFGKEYVEDKYGLCEAPNNMDTVLDVATEVTFYGLEQYEE |
| Sec Struct: | HHHHHHHHHHHHHHHHT-TT-S-SSHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | D - 344 | 1 | 0 |
| GOLGLYCEROL | D - 345 | 1 | 0 |
| GOLGLYCEROL | F - 346 | 1 | 0 |
| GOLGLYCEROL | Y - 348 | 1 | 0 |
| GOLGLYCEROL | F - 349 | 1 | 0 |
| GOLGLYCEROL | E - 352 | 1 | 0 |
| GOLGLYCEROL | Y - 380 | 1 | 0 |
| MGMAGNESIUM ION | Y - 385 | 1 | 0 |
| MGN2-METHYL-GLUTAMINE | Y - 385 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|