|
|
|
|
|
|
|
| Information on 1clc_*_318 |
|
Loop code: 1clc_*_318 PDB: 1clc Chain: * Type: HH alpha-alpha |
Loop Start: 318 Loop Length: 22 Sec Struct Nt length: 20 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | PQYAEKCINAAKVSYEFLKNNPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETL |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHH--S------TT--S-----S-SHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | T - 356 | 0 | 1 |
| CACALCIUM ION | V - 357 | 0 | 1 |
| CACALCIUM ION | S - 358 | 0 | 1 |
| CACALCIUM ION | D - 359 | 0 | 1 |
| CACALCIUM ION | A - 360 | 0 | 1 |
| CACALCIUM ION | D - 361 | 1 | 0 |
| CACALCIUM ION | D - 362 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|