|
|
|
|
|
|
|
| Information on 1llf_A_371 |
|
Loop code: 1llf_A_371 PDB: 1llf Chain: A Type: HH alpha-alpha |
Loop Start: 371 Loop Length: 22 Sec Struct Nt length: 10 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | DAEIDTLMAAYPQDITQGSPFDTGIFNAITPQFKRISAVLGDLA |
| Sec Struct: | HHHHHHHHHHS-S-GGGSSSTT-TTTT-SSSSHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| F23TRICOSANOIC ACID | L - 377 | 1 | 0 |
| F23TRICOSANOIC ACID | I - 406 | 1 | 0 |
| F23TRICOSANOIC ACID | V - 409 | 1 | 0 |
| F23TRICOSANOIC ACID | L - 410 | 1 | 0 |
| F23TRICOSANOIC ACID | L - 413 | 1 | 0 |
| F23TRICOSANOIC ACID | A - 414 | 1 | 0 |
| Associated ArchDB95 Subclass to 1llf_A_371 |
| Associated ArchDB-EC Subclass to 1llf_A_371 |
| For any comment or web-related incidence, send an email to the webmaster. |
|