|
|
|
|
|
|
|
| Information on 1m1n_B_50 |
|
Loop code: 1m1n_B_50 PDB: 1m1n Chain: B Type: HH alpha-alpha |
Loop Start: 50 Loop Length: 13 Sec Struct Nt length: 8 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | KEYQELNFQREALTVNPAKACQPLGAVLCA |
| Sec Struct: | HHHHHHHHT-SS---S-S---HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CLFFE(8)-S(7) CLUSTER | C - 70 | 0 | 1 |
| CLFFE(8)-S(7) CLUSTER | Q - 71 | 0 | 1 |
| CLFFE(8)-S(7) CLUSTER | P - 72 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|