|
|
|
|
|
|
|
| Information on 1esw_A_97 |
|
Loop code: 1esw_A_97 PDB: 1esw Chain: A Type: HH alpha-alpha |
Loop Start: 97 Loop Length: 2 Sec Struct Nt length: 22 Sec Struct Ct length: 30 Structure geometry
|
| Sequence: | YGLLYAWKWPALKEAFRGFKEKASPEEREAFAAFREREAWWLEDYALFMALKGA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACRACARBOSE | Y - 97 | 1 | 0 |
| ACRACARBOSE | G - 98 | 1 | 0 |
| ACRACARBOSE | L - 99 | 1 | 0 |
| ACRACARBOSE | Y - 101 | 1 | 0 |
| EDO1,2-ETHANEDIOL | Y - 101 | 1 | 0 |
| EDO1,2-ETHANEDIOL | W - 105 | 1 | 0 |
| EDO1,2-ETHANEDIOL | K - 109 | 1 | 0 |
| EDO1,2-ETHANEDIOL | M - 145 | 1 | 0 |
| ACRACARBOSE | K - 148 | 1 | 0 |
| EDO1,2-ETHANEDIOL | G - 149 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|