|
|
|
|
|
|
|
| Information on 1f5a_A_195 |
|
Loop code: 1f5a_A_195 PDB: 1f5a Chain: A Type: HH alpha-alpha |
Loop Start: 195 Loop Length: 4 Sec Struct Nt length: 18 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | IRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKR |
| Sec Struct: | HHHHHHHHHHHHHHHHHHTSS-HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 3AT3'-DEOXYADENOSINE-5'-TRIPHOSPHATE | G - 203 | 1 | 0 |
| MSESELENOMETHIONINE | V - 206 | 1 | 0 |
| 3AT3'-DEOXYADENOSINE-5'-TRIPHOSPHATE | T - 207 | 1 | 0 |
| MSESELENOMETHIONINE | I - 210 | 1 | 0 |
| MSESELENOMETHIONINE | F - 220 | 1 | 0 |
| 3AT3'-DEOXYADENOSINE-5'-TRIPHOSPHATE | K - 228 | 1 | 0 |
| MSESELENOMETHIONINE | W - 230 | 1 | 0 |
| 3AT3'-DEOXYADENOSINE-5'-TRIPHOSPHATE | K - 232 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|