|
|
|
|
|
|
|
| Information on 1fxx_A_137 |
|
Loop code: 1fxx_A_137 PDB: 1fxx Chain: A Type: HH alpha-alpha |
Loop Start: 137 Loop Length: 15 Sec Struct Nt length: 11 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | LLDVMRACYALRPEGINWPEGLPSFRLEHLTK |
| Sec Struct: | HHHHHHHHHHH--TTS----------HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | D - 139 | 1 | 0 |
| GOLGLYCEROL | R - 142 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|