Information on 1r31_A_336 |
Loop code: 1r31_A_336 PDB: 1r31 Chain: A Type: HH alpha-alpha |
Loop Start: 336 Loop Length: 4 Sec Struct Nt length: 10 Sec Struct Ct length: 24 Structure geometry
|
Sequence: | PLAQLSLRILGVKTAQALAEIAVAVGLAQNLGAMRALA |
Sec Struct: | HHHHHHHHHHT-SSHHHHHHHHHHHHHHHHHHHHHHHH |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
COACOENZYME A | Q - 364 | 1 | 0 |
MEV(R)-MEVALONATE | N - 365 | 1 | 0 |
COACOENZYME A | G - 367 | 1 | 0 |
COACOENZYME A | A - 368 | 1 | 0 |
MEV(R)-MEVALONATE | A - 368 | 1 | 0 |
COACOENZYME A | M - 369 | 1 | 0 |
MEV(R)-MEVALONATE | M - 369 | 1 | 0 |
COACOENZYME A | R - 370 | 1 | 0 |
COACOENZYME A | A - 371 | 1 | 0 |
MEV(R)-MEVALONATE | L - 372 | 1 | 0 |
Associated ArchDB-EC Subclass to 1r31_A_336 |