|
|
|
|
|
|
|
| Information on 1yaa_A_276 |
|
Loop code: 1yaa_A_276 PDB: 1yaa Chain: A Type: HH alpha-alpha |
Loop Start: 276 Loop Length: 7 Sec Struct Nt length: 17 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | NKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLE |
| Sec Struct: | HHHHHHHHHHHHHHHHHTTTSS--HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MAEMALEIC ACID | R - 292 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | V - 295 | 0 | 1 |
| MAEMALEIC ACID | S - 296 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | S - 296 | 0 | 1 |
| MAEMALEIC ACID | N - 297 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | N - 297 | 0 | 1 |
| Associated ArchDB95 Subclass to 1yaa_A_276 |
| Associated ArchDB-EC Subclass to 1yaa_A_276 |
| For any comment or web-related incidence, send an email to the webmaster. |
|