|
|
|
|
|
|
|
| Information on 2cst_A_277 |
|
Loop code: 2cst_A_277 PDB: 2cst Chain: A Type: HH alpha-alpha |
Loop Start: 277 Loop Length: 8 Sec Struct Nt length: 16 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | EDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLT |
| Sec Struct: | HHHHHHHHHHHHHHHHTTTSS--SHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MAEMALEIC ACID | R - 292 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | W - 295 | 0 | 1 |
| MAEMALEIC ACID | S - 296 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | S - 296 | 0 | 1 |
| MAEMALEIC ACID | N - 297 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | N - 297 | 0 | 1 |
| Associated ArchDB95 Subclass to 2cst_A_277 |
| Associated ArchDB-EC Subclass to 2cst_A_277 |
| For any comment or web-related incidence, send an email to the webmaster. |
|