Information on 1xim_A_15 |
Loop code: 1xim_A_15 PDB: 1xim Chain: A Type: HH alpha-alpha |
Loop Start: 15 Loop Length: 17 Sec Struct Nt length: 4 Sec Struct Ct length: 11 Structure geometry
|
Sequence: | LWTVGWQARDAFGDATRTALDPVEAVHKLAEI |
Sec Struct: | HHHHT----BTTB--SS----HHHHHHHHHHH |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
COCOBALT (II) ION | W - 16 | 1 | 0 |
XYLD-XYLITOL | W - 16 | 1 | 0 |
COCOBALT (II) ION | F - 26 | 0 | 1 |
XYLD-XYLITOL | F - 26 | 0 | 1 |
Associated ArchDB95 Subclass to 1xim_A_15 |
Associated ArchDB-EC Subclass to 1xim_A_15 |