|
|
|
|
|
|
|
| Information on 1fi4_A_120 |
|
Loop code: 1fi4_A_120 PDB: 1fi4 Chain: A Type: HH alpha-alpha |
Loop Start: 120 Loop Length: 6 Sec Struct Nt length: 16 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | SSAAGFAALVSAIAKLYQLPQSTSEISRIARKGS |
| Sec Struct: | HHHHHHHHHHHHHHHHTT--S-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 136 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 137 | 0 | 1 |
| MSESELENOMETHIONINE | L - 138 | 0 | 1 |
| MSESELENOMETHIONINE | P - 139 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 140 | 0 | 1 |
| MSESELENOMETHIONINE | S - 143 | 1 | 0 |
| MSESELENOMETHIONINE | E - 144 | 1 | 0 |
| MSESELENOMETHIONINE | S - 146 | 1 | 0 |
| MSESELENOMETHIONINE | R - 147 | 1 | 0 |
| MSESELENOMETHIONINE | R - 150 | 1 | 0 |
| Associated ArchDB40 Subclass to 1fi4_A_120 |
| Associated ArchDB95 Subclass to 1fi4_A_120 |
| For any comment or web-related incidence, send an email to the webmaster. |
|