|
|
|
|
|
|
|
| Information on 1fi4_A_257 |
|
Loop code: 1fi4_A_257 PDB: 1fi4 Chain: A Type: HH alpha-alpha |
Loop Start: 257 Loop Length: 9 Sec Struct Nt length: 9 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | SNSFHATCLDSFPPIFYNDTSKRIISWCHTINQFY |
| Sec Struct: | HHHHHHHHHTSSS-----HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 257 | 1 | 0 |
| MSESELENOMETHIONINE | N - 258 | 1 | 0 |
| MSESELENOMETHIONINE | S - 259 | 1 | 0 |
| MSESELENOMETHIONINE | F - 260 | 1 | 0 |
| MSESELENOMETHIONINE | H - 261 | 1 | 0 |
| MSESELENOMETHIONINE | I - 271 | 0 | 1 |
| MSESELENOMETHIONINE | F - 272 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 273 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|