|
|
|
|
|
|
|
| Information on 1pie_A_160 |
|
Loop code: 1pie_A_160 PDB: 1pie Chain: A Type: HH alpha-alpha |
Loop Start: 160 Loop Length: 8 Sec Struct Nt length: 14 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | RLELVQLGQKTENDYIGVNSGILDQFAIGF |
| Sec Struct: | HHHHHHHHHHHHHHTT-----SHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GALD-GALACTOSE | E - 171 | 1 | 0 |
| GALD-GALACTOSE | N - 178 | 0 | 1 |
| GALD-GALACTOSE | S - 179 | 0 | 1 |
| GALD-GALACTOSE | G - 180 | 0 | 1 |
| GALD-GALACTOSE | I - 181 | 0 | 1 |
| GALD-GALACTOSE | L - 182 | 0 | 1 |
| GALD-GALACTOSE | D - 183 | 1 | 0 |
| PO4PHOSPHATE ION | D - 183 | 1 | 0 |
| GALD-GALACTOSE | Q - 184 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|