|
|
|
|
|
|
|
| Information on 1h0c_A_35 |
|
Loop code: 1h0c_A_35 PDB: 1h0c Chain: A Type: HH alpha-alpha |
Loop Start: 35 Loop Length: 9 Sec Struct Nt length: 7 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | PRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVF |
| Sec Struct: | HHHHHHHT-----TTSHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | P - 35 | 1 | 0 |
| GOLGLYCEROL | R - 36 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC6 - GOL BINDING SITE FOR CHAIN A | D - 52 | 1 | 0 |
| AC6 - GOL BINDING SITE FOR CHAIN A | Q - 55 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|