|
|
|
|
|
|
|
| Information on 1ni4_A_275 |
|
Loop code: 1ni4_A_275 PDB: 1ni4 Chain: A Type: HH alpha-alpha |
Loop Start: 275 Loop Length: 15 Sec Struct Nt length: 11 Sec Struct Ct length: 24 Structure geometry
|
| Sequence: | REEIQEVRSKSDPILLKDRVNSNLASVEELKEIDVEVRKEIEDAAQFATA |
| Sec Struct: | HHHHHHHHHHH----TTT--TTSSS-HHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | V - 281 | 1 | 0 |
| MSESELENOMETHIONINE | R - 282 | 1 | 0 |
| MSESELENOMETHIONINE | S - 283 | 1 | 0 |
| MSESELENOMETHIONINE | K - 284 | 0 | 1 |
| MSESELENOMETHIONINE | S - 285 | 0 | 1 |
| MSESELENOMETHIONINE | D - 286 | 0 | 1 |
| MSESELENOMETHIONINE | P - 287 | 0 | 1 |
| MSESELENOMETHIONINE | I - 288 | 0 | 1 |
| MSESELENOMETHIONINE | L - 290 | 0 | 1 |
| MSESELENOMETHIONINE | N - 297 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|