|
|
|
|
|
|
|
| Information on 1f0j_A_377 |
|
Loop code: 1f0j_A_377 PDB: 1f0j Chain: A Type: HH alpha-alpha |
Loop Start: 377 Loop Length: 7 Sec Struct Nt length: 16 Sec Struct Ct length: 24 Structure geometry
|
| Sequence: | YTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERE |
| Sec Struct: | HHHHHHHHHHHHHHHHT-GGGS-HHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ARSARSENIC | D - 392 | 0 | 1 |
| MGMAGNESIUM ION | D - 392 | 0 | 1 |
| ZNZINC ION | D - 392 | 0 | 1 |
| ARSARSENIC | L - 393 | 0 | 1 |
| ARSARSENIC | I - 410 | 1 | 0 |
| ARSARSENIC | F - 414 | 1 | 0 |
| Associated ArchDB40 Subclass to 1f0j_A_377 |
| Associated ArchDB95 Subclass to 1f0j_A_377 |
| For any comment or web-related incidence, send an email to the webmaster. |
|