|
|
|
|
|
|
|
| Information on 1h7n_A_217 |
|
Loop code: 1h7n_A_217 PDB: 1h7n Chain: A Type: HH alpha-alpha |
Loop Start: 217 Loop Length: 18 Sec Struct Nt length: 7 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMS |
| Sec Struct: | HHHHHHHT---SSS-STTTSB-TT-HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SHFLAEVULINIC ACID | G - 217 | 1 | 0 |
| SHFLAEVULINIC ACID | P - 218 | 1 | 0 |
| SHFLAEVULINIC ACID | F - 219 | 1 | 0 |
| SHFLAEVULINIC ACID | R - 220 | 1 | 0 |
| ZNZINC ION | R - 232 | 0 | 1 |
| ZNZINC ION | Y - 235 | 0 | 1 |
| ZNZINC ION | Q - 236 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC1 - SHF BINDING SITE FOR CHAIN A | F - 219 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|