|
|
|
|
|
|
|
| Information on 1dce_B_239 |
|
Loop code: 1dce_B_239 PDB: 1dce Chain: B Type: HH alpha-alpha |
Loop Start: 239 Loop Length: 7 Sec Struct Nt length: 14 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | VCYSWWVLASLKIIGRLHWIDREKLRSFIL |
| Sec Struct: | HHHHHHHHHHHHHHT-GGGS-HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | V - 239 | 1 | 0 |
| ZNZINC ION | C - 240 | 1 | 0 |
| ZNZINC ION | Y - 241 | 1 | 0 |
| ZNZINC ION | W - 244 | 1 | 0 |
| Associated ArchDB40 Subclass to 1dce_B_239 |
| Associated ArchDB95 Subclass to 1dce_B_239 |
| Associated ArchDB-EC Subclass to 1dce_B_239 |
| For any comment or web-related incidence, send an email to the webmaster. |
|