|
|
|
|
|
|
|
| Information on 4lip_D_243 |
|
Loop code: 4lip_D_243 PDB: 4lip Chain: D Type: HH alpha-alpha |
Loop Start: 243 Loop Length: 12 Sec Struct Nt length: 14 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | PSTLALFGTGTVMVNRGSGQNDGVVSKCSA |
| Sec Struct: | HHHHHHHHHHHHHHTTT--SBSSSSBHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | S - 244 | 1 | 0 |
| CACALCIUM ION | T - 245 | 1 | 0 |
| CCPBUTYLPHOSPHONATE | V - 266 | 0 | 1 |
| CCPBUTYLPHOSPHONATE | V - 267 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| ACD - ACTIVE SITE | D - 264 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|