|
|
|
|
|
|
|
| Information on 1lc0_A_249 |
|
Loop code: 1lc0_A_249 PDB: 1lc0 Chain: A Type: HH alpha-alpha |
Loop Start: 249 Loop Length: 5 Sec Struct Nt length: 13 Sec Struct Ct length: 24 Structure geometry
|
| Sequence: | IFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKL |
| Sec Struct: | HHHHHHHHHHHHHTT-S-HHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | L - 281 | 1 | 0 |
| PO4PHOSPHATE ION | S - 285 | 1 | 0 |
| PO4PHOSPHATE ION | Q - 288 | 1 | 0 |
| PO4PHOSPHATE ION | K - 289 | 1 | 0 |
| Associated ArchDB40 Subclass to 1lc0_A_249 |
| Associated ArchDB95 Subclass to 1lc0_A_249 |
| Associated ArchDB-EC Subclass to 1lc0_A_249 |
| For any comment or web-related incidence, send an email to the webmaster. |
|