|
|
|
|
|
|
|
| Information on 1h5r_A_230 |
|
Loop code: 1h5r_A_230 PDB: 1h5r Chain: A Type: HH alpha-alpha |
Loop Start: 230 Loop Length: 6 Sec Struct Nt length: 18 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | HQSLIEASNFIATIEERQGLKVSCPEEIAFR |
| Sec Struct: | HHHHHHHHHHHHHHHHHHT--SS-HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| G1PALPHA-D-GLUCOSE-1-PHOSPHATE | R - 246 | 0 | 1 |
| THMTHYMIDINE | K - 250 | 0 | 1 |
| THMTHYMIDINE | V - 251 | 0 | 1 |
| THMTHYMIDINE | S - 252 | 0 | 1 |
| THMTHYMIDINE | C - 253 | 0 | 1 |
| THMTHYMIDINE | E - 256 | 1 | 0 |
| THMTHYMIDINE | I - 257 | 1 | 0 |
| THMTHYMIDINE | R - 260 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| THM - THM BINDING SITE FOR CHAIN D | E - 256 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|