|
|
|
|
|
|
|
| Information on 1h0o_A_150 |
|
Loop code: 1h0o_A_150 PDB: 1h0o Chain: A Type: HH alpha-alpha |
Loop Start: 150 Loop Length: 3 Sec Struct Nt length: 4 Sec Struct Ct length: 28 Structure geometry
|
| Sequence: | FSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTY |
| Sec Struct: | HHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| COCOBALT (II) ION | Q - 166 | 1 | 0 |
| COCOBALT (II) ION | E - 170 | 1 | 0 |
| COCOBALT (II) ION | H - 173 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CO1CO BINDING SITE FOR CHAIN A | Q - 166 | 1 | 0 |
| CO1CO BINDING SITE FOR CHAIN A | E - 170 | 1 | 0 |
| Associated ArchDB40 Subclass to 1h0o_A_150 |
| For any comment or web-related incidence, send an email to the webmaster. |
|