|
|
|
|
|
|
|
| Information on 1h0o_A_254 |
|
Loop code: 1h0o_A_254 PDB: 1h0o Chain: A Type: HH alpha-alpha |
Loop Start: 254 Loop Length: 7 Sec Struct Nt length: 26 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | PGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEFLT |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHT-SS---HHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| COCOBALT (II) ION | D - 266 | 1 | 0 |
| COCOBALT (II) ION | E - 267 | 1 | 0 |
| COCOBALT (II) ION | H - 270 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CO1 - CO BINDING SITE FOR CHAIN A | E - 267 | 1 | 0 |
| CO1 - CO BINDING SITE FOR CHAIN A | H - 270 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|