|
|
|
|
|
|
|
| Information on 1p8j_A_173 |
|
Loop code: 1p8j_A_173 PDB: 1p8j Chain: A Type: EH beta-alpha |
Loop Start: 173 Loop Length: 19 Sec Struct Nt length: 2 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | FDVNDQDPDPQPRYTQMNDNRHGTRCAGEVA |
| Sec Struct: | EETTTTBS-------TT-TT-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ARMDEOXY-METHYL-ARGININE | H - 194 | 0 | 1 |
| CACALCIUM ION | H - 194 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|