|
|
|
|
|
|
|
| Information on 1f52_A_146 |
|
Loop code: 1f52_A_146 PDB: 1f52 Chain: A Type: EH beta-alpha |
Loop Start: 146 Loop Length: 36 Sec Struct Nt length: 7 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GSHVAIDDIEGAWNSSTKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQ |
| Sec Struct: | EEEEEEE-TT-GGGGG---TT--------TT--SS--TTSS--HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MNMANGANESE (II) ION | Y - 179 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | Q - 189 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | D - 190 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | I - 191 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | R - 192 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | S - 193 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | E - 194 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|