|
|
|
|
|
|
|
| Information on 2frv_A_228 |
|
Loop code: 2frv_A_228 PDB: 2frv Chain: A Type: HH alpha-alpha |
Loop Start: 228 Loop Length: 22 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | CPKQLFNQVNWPVQAGHPCIACSEPNFWDL |
| Sec Struct: | HHHH-BTTTB-GGGGT-----TTSTTHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FS3FE3-S4 CLUSTER | C - 228 | 1 | 0 |
| FS3FE3-S4 CLUSTER | F - 233 | 0 | 1 |
| FS3FE3-S4 CLUSTER | W - 238 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | W - 238 | 0 | 1 |
| FS3FE3-S4 CLUSTER | P - 239 | 0 | 1 |
| FS3FE3-S4 CLUSTER | V - 240 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | V - 240 | 0 | 1 |
| FS3FE3-S4 CLUSTER | P - 245 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | P - 245 | 0 | 1 |
| FS3FE3-S4 CLUSTER | C - 246 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | C - 246 | 0 | 1 |
| FS3FE3-S4 CLUSTER | I - 247 | 0 | 1 |
| FS3FE3-S4 CLUSTER | A - 248 | 0 | 1 |
| FS3FE3-S4 CLUSTER | C - 249 | 0 | 1 |
| FS3FE3-S4 CLUSTER | S - 250 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | W - 255 | 1 | 0 |
| Associated ArchDB-EC Subclass to 2frv_A_228 |
| For any comment or web-related incidence, send an email to the webmaster. |
|