|
|
|
|
|
|
|
| Information on 1hbn_C_10 |
|
Loop code: 1hbn_C_10 PDB: 1hbn Chain: C Type: HH alpha-alpha |
Loop Start: 10 Loop Length: 13 Sec Struct Nt length: 10 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | KVAQNRRNFCNPEYELEKLREISDEDVVKIL |
| Sec Struct: | HHHHHHHHHH-TTS---B-----HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | K - 27 | 0 | 1 |
| MGMAGNESIUM ION | E - 30 | 0 | 1 |
| MGMAGNESIUM ION | I - 31 | 0 | 1 |
| MGMAGNESIUM ION | S - 32 | 0 | 1 |
| MGMAGNESIUM ION | D - 33 | 0 | 1 |
| MGMAGNESIUM ION | E - 34 | 1 | 0 |
| MGMAGNESIUM ION | D - 35 | 1 | 0 |
| MGMAGNESIUM ION | K - 38 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|