|
|
|
|
|
|
|
| Information on 1kf6_B_107 |
|
Loop code: 1kf6_B_107 PDB: 1kf6 Chain: B Type: HH alpha-alpha |
Loop Start: 107 Loop Length: 20 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | THFIESLEAIKPYIIGNSRTADQGTNIQTPAQMA |
| Sec Struct: | HHHHHHHHHT--S--S----GGG------HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FS4IRON/SULFUR CLUSTER | F - 109 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|