|
|
|
|
|
|
|
| Information on 1qhf_A_12 |
|
Loop code: 1qhf_A_12 PDB: 1qhf Chain: A Type: HH alpha-alpha |
Loop Start: 12 Loop Length: 13 Sec Struct Nt length: 4 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | EWNEKNLFTGWVDVKLSAKGQQEAARAGELLKE |
| Sec Struct: | HHHHTTB--TTS---B-HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 3PG3-PHOSPHOGLYCERIC ACID | W - 13 | 1 | 0 |
| 3PG3-PHOSPHOGLYCERIC ACID | N - 14 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | E - 15 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | L - 18 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | F - 19 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | T - 20 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | G - 21 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | V - 25 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | E - 34 | 1 | 0 |
| Associated ArchDB95 Subclass to 1qhf_A_12 |
| For any comment or web-related incidence, send an email to the webmaster. |
|