|
|
|
|
|
|
|
| Information on 1ryp_1_49 |
|
Loop code: 1ryp_1_49 PDB: 1ryp Chain: 1 Type: HH alpha-alpha |
Loop Start: 49 Loop Length: 7 Sec Struct Nt length: 21 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | AADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLY |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHTTT----HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | Y - 66 | 1 | 0 |
| MGMAGNESIUM ION | K - 73 | 0 | 1 |
| MGMAGNESIUM ION | K - 74 | 0 | 1 |
| MGMAGNESIUM ION | L - 75 | 0 | 1 |
| MGMAGNESIUM ION | S - 76 | 0 | 1 |
| MGMAGNESIUM ION | N - 78 | 1 | 0 |
| MGMAGNESIUM ION | S - 79 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|