|
|
|
|
|
|
|
| Information on 1p7g_A_46 |
|
Loop code: 1p7g_A_46 PDB: 1p7g Chain: A Type: HH alpha-alpha |
Loop Start: 46 Loop Length: 7 Sec Struct Nt length: 20 Sec Struct Ct length: 21 Structure geometry
|
| Sequence: | HHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIF |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHTTSS---HHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | R - 74 | 1 | 0 |
| MSESELENOMETHIONINE | L - 77 | 1 | 0 |
| MSESELENOMETHIONINE | R - 78 | 1 | 0 |
| MSESELENOMETHIONINE | S - 81 | 1 | 0 |
| MSESELENOMETHIONINE | N - 85 | 1 | 0 |
| MSESELENOMETHIONINE | I - 92 | 1 | 0 |
| MSESELENOMETHIONINE | F - 93 | 1 | 0 |
| Associated ArchDB95 Subclass to 1p7g_A_46 |
| Associated ArchDB-EC Subclass to 1p7g_A_46 |
| For any comment or web-related incidence, send an email to the webmaster. |
|