|
|
|
|
|
|
|
| Information on 1iyh_A_82 |
|
Loop code: 1iyh_A_82 PDB: 1iyh Chain: A Type: HH alpha-alpha |
Loop Start: 82 Loop Length: 9 Sec Struct Nt length: 18 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | EMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTY |
| Sec Struct: | HHHHHHHHHHHHHHHHHHTTS-TT-S-HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GSHGLUTHATHIONE | D - 93 | 1 | 0 |
| MGMAGNESIUM ION | D - 93 | 1 | 0 |
| GSHGLUTHATHIONE | D - 96 | 1 | 0 |
| MGMAGNESIUM ION | D - 96 | 1 | 0 |
| GSHGLUTHATHIONE | D - 97 | 1 | 0 |
| MGMAGNESIUM ION | D - 97 | 1 | 0 |
| GSHGLUTHATHIONE | S - 100 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|