|
|
|
|
|
|
|
| Information on 1o6b_A_129 |
|
Loop code: 1o6b_A_129 PDB: 1o6b Chain: A Type: HH alpha-alpha |
Loop Start: 129 Loop Length: 10 Sec Struct Nt length: 9 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | SSIVKEVARYDGSVSEFVPPEVELALQQKFR |
| Sec Struct: | HHHHHHHHHTT---TTTS-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ADPADENOSINE-5'-DIPHOSPHATE | S - 129 | 1 | 0 |
| PO4PHOSPHATE ION | S - 129 | 1 | 0 |
| PO4PHOSPHATE ION | S - 130 | 1 | 0 |
| MGMAGNESIUM ION | A - 136 | 0 | 1 |
| MGMAGNESIUM ION | D - 139 | 0 | 1 |
| MGMAGNESIUM ION | G - 140 | 0 | 1 |
| MGMAGNESIUM ION | Q - 155 | 1 | 0 |
| Associated ArchDB95 Subclass to 1o6b_A_129 |
| Associated ArchDB-EC Subclass to 1o6b_A_129 |
| For any comment or web-related incidence, send an email to the webmaster. |
|