|
|
|
|
|
|
|
| Information on 1mio_B_198 |
|
Loop code: 1mio_B_198 PDB: 1mio Chain: B Type: EH beta-alpha |
Loop Start: 198 Loop Length: 25 Sec Struct Nt length: 3 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | YIMFPDTSGVLDGPTTGEYKMYPEGGTKIEDLK |
| Sec Struct: | EEESS--TTTSS----SS--SS-S-SB-HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | L - 208 | 0 | 1 |
| CACALCIUM ION | D - 209 | 0 | 1 |
| CACALCIUM ION | G - 210 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|